Big dynorphin

Opioid peptide

Big dynorphin is an endogenous opioid peptide of the dynorphin family that is composed of both dynorphin A and dynorphin B.^[1]^[2] Big dynorphin has the amino acid sequence: Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr.^[2] It has nociceptive and anxiolytic-like properties, as well as effects on memory in mice.^[3]^[4]

Big dynorphin is a principal endogenous, agonist at the human kappa-opioid receptor.^[1]^[5]

References

^ ^a ^b "Big dynorphin: Biological activity". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Principal endogenous agonists at κ receptor
^ ^a ^b "Big dynorphin: Structure – Peptide Sequence". IUPHAR/BPS Guide to PHARMACOLOGY. International Union of Basic and Clinical Pharmacology. Retrieved 20 October 2017. Peptide sequence
YGGFLRRIRPKLKWDNQKRYGGFLRRQFKVVT
Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Ile-Arg-Pro-Lys-Leu-Lys-Trp-Asp-Asn-Gln-Lys-Arg-Tyr-Gly-Gly-Phe-Leu-Arg-Arg-Gln-Phe-Lys-Val-Val-Thr
^ Kuzmin, Alexander; Madjid, Nather; Terenius, Lars; Ogren, Sven Ove; Bakalkin, Georgy (2005). "Big Dynorphin, a Prodynorphin-Derived Peptide Produces NMDA Receptor-Mediated Effects on Memory, Anxiolytic-Like and Locomotor Behavior in Mice". Neuropsychopharmacology. 31 (9): 1928–1937. doi:10.1038/sj.npp.1300959. ISSN 0893-133X. PMID 16292317.
^ Tan-No K, Esashi A, Nakagawasai O, et al. (2002). "Intrathecally administered big dynorphin, a prodynorphin-derived peptide, produces nociceptive behavior through an N-methyl-D-aspartate receptor mechanism". Brain Res. 952 (1): 7–14. doi:10.1016/S0006-8993(02)03180-3. PMID 12363399. S2CID 1734522.
^ Merg F, Filliol D, Usynin I, et al. (2006). "Big dynorphin as a putative endogenous ligand for the kappa-opioid receptor". J. Neurochem. 97 (1): 292–301. doi:10.1111/j.1471-4159.2006.03732.x. PMID 16515546.

Peptides: neuropeptides

Hormones

see hormones

Opioid peptides

Dynorphins	Dynorphin A Dynorphin A_1–8 Dynorphin B Big dynorphin Leumorphin α-Neoendorphin β-Neoendorphin
Endomorphins	Endomorphin-1 Endomorphin-2
Endorphins	α-Endorphin β-Endorphin γ-Endorphin
Enkephalins	Met-enkephalin Leu-enkephalin
Others	Adrenorphin Amidorphin Hemorphin Hemorphin-4 Nociceptin Opiorphin Spinorphin Valorphin

Other
neuropeptides

Kinins	Bradykinins Tachykinins: mammal Substance P Neurokinin A Neurokinin B amphibian Kassinin Physalaemin
Neuromedins	B N S U
Orexins	A B
Other	Angiotensin Bombesin Calcitonin gene-related peptide Carnosine Cocaine- and amphetamine-regulated transcript Delta-sleep-inducing peptide FMRFamide Galanin Galanin-like peptide Gastrin-releasing peptide Ghrelin Neuropeptide AF Neuropeptide FF Neuropeptide SF Neuropeptide VF Neuropeptide S Neuropeptide Y Neurophysins Neurotensin Pancreatic polypeptide Pituitary adenylate cyclase-activating peptide RVD-Hpα VGF