ADCYAP1

ADCYAP1
Наявні структури
PDBПошук ортологів: PDBe RCSB
Список кодів PDB

1GEA, 2D2P, 2JOD

Ідентифікатори
Символи ADCYAP1, PACAP, adenylate cyclase activating polypeptide 1
Зовнішні ІД OMIM: 102980 MGI: 105094 HomoloGene: 869 GeneCards: ADCYAP1
Пов'язані генетичні захворювання
ожиріння[1]
Онтологія гена
Молекулярна функція

• pituitary adenylate cyclase activating polypeptide activity
• hormone activity
• peptide hormone receptor binding
• GO:0001948, GO:0016582 protein binding
• pituitary adenylate cyclase-activating polypeptide receptor binding
• нейропептидна гормональна активність
• signaling receptor binding

Клітинна компонента

• внутрішньоклітинний
• extracellular region
• terminal bouton
• міжклітинний простір
• neuron projection
• перикаріон
• cell body fiber

Біологічний процес

• histamine secretion
• pituitary gland development
• regulation of G protein-coupled receptor signaling pathway
• negative regulation of glial cell proliferation
• жіноча вагітність
• cell-cell signaling
• negative regulation of cell cycle
• negative regulation of muscle cell apoptotic process
• behavioral fear response
• нейробіологія розвитку
• activation of adenylate cyclase activity
• regulation of protein localization
• GO:0032320, GO:0032321, GO:0032855, GO:0043089, GO:0032854 positive regulation of GTPase activity
• ATP metabolic process
• negative regulation of acute inflammatory response to non-antigenic stimulus
• regulation of oligodendrocyte progenitor proliferation
• cellular response to glucocorticoid stimulus
• GO:1901313 positive regulation of gene expression
• GO:0034259 negative regulation of GTPase activity
• positive regulation of synaptic transmission, glutamatergic
• positive regulation of chemokine (C-C motif) ligand 5 production
• regulation of postsynaptic membrane potential
• positive regulation of cell population proliferation
• negative regulation of potassium ion transport
• positive regulation of ERK1 and ERK2 cascade
• positive regulation of interleukin-6 production
• positive regulation of neuron projection development
• response to starvation
• ovarian follicle development
• sensory perception of pain
• response to ethanol
• negative regulation of acute inflammatory response to antigenic stimulus
• neuropeptide signaling pathway
• neuron projection development
• cAMP-mediated signaling
• positive regulation of somatostatin secretion
• GO:0003257, GO:0010735, GO:1901228, GO:1900622, GO:1904488 positive regulation of transcription by RNA polymerase II
• positive regulation of protein kinase activity
• regulation of protein phosphorylation
• positive regulation of cytosolic calcium ion concentration
• insulin secretion
• positive regulation of growth hormone secretion
• regulation of signaling receptor activity
• G protein-coupled receptor signaling pathway
• adenylate cyclase-activating G protein-coupled receptor signaling pathway
• positive regulation of cAMP-mediated signaling
• brain development
• camera-type eye development
• positive regulation of cold-induced thermogenesis

Джерела:Amigo / QuickGO
Шаблон експресії
Більше даних
Ортологи
Види Людина Миша
Entrez
116
11516
Ensembl
ENSG00000141433
ENSMUSG00000024256
UniProt
P18509
O70176
RefSeq (мРНК)
NM_001099733
NM_001117
NM_009625
NM_001315503
NM_001315504
RefSeq (білок)
NP_001093203
NP_001108
NP_001302432
NP_001302433
NP_033755
Локус (UCSC) Хр. 18: 0.9 – 0.91 Mb Хр. 17: 93.51 – 93.51 Mb
PubMed search [2] [3]
Вікідані
Див./Ред. для людейДив./Ред. для мишей

ADCYAP1 (англ. Adenylate cyclase activating polypeptide 1) – білок, який кодується однойменним геном, розташованим у людей на короткому плечі 18-ї хромосоми.[4] Довжина поліпептидного ланцюга білка становить 176 амінокислот, а молекулярна маса — 18 835[5].

Послідовність амінокислот
1020304050
MTMCSGARLALLVYGIIMHSSVYSSPAAAGLRFPGIRPEEEAYGEDGNPL
PDFDGSEPPGAGSPASAPRAAAAWYRPAGRRDVAHGILNEAYRKVLDQLS
AGKHLQSLVARGVGGSLGGGAGDDAEPLSKRHSDGIFTDSYSRYRKQMAV
KKYLAAVLGKRYKQRVKNKGRRIAYL

Кодований геном білок за функцією належить до гормонів. Задіяний у такому біологічному процесі, як нейрогенез. Секретований назовні.

Література

  • The status, quality, and expansion of the NIH full-length cDNA project: the Mammalian Gene Collection (MGC). Genome Res. 14: 2121—2127. 2004. PMID 15489334 DOI:10.1101/gr.2596504
  • Emery A.C., Eiden M.V., Mustafa T., Eiden L.E. (2013). Rapgef2 Connects GPCR-Mediated cAMP Signals to ERK Activation in Neuronal and Endocrine Cells. Sci. Signal. 6: RA51—RA51. PMID 23800469 DOI:10.1126/scisignal.2003993
  • Wray V., Kakoschke C., Nokihara K., Naruse S. (1993). Solution structure of pituitary adenylate cyclase activating polypeptide by nuclear magnetic resonance spectroscopy. Biochemistry. 32: 5832—5841. PMID 8504103 DOI:10.1021/bi00073a016
  • Gu H.F. (2002). Genetic variation screening and association studies of the adenylate cyclase activating polypeptide 1 (ADCYAP1) gene in patients with type 2 diabetes. Hum. Mutat. 19: 572—573. PMID 11968092 DOI:10.1002/humu.9034
  • Inooka H., Endo S., Kitada C., Mizuta E., Fujino M. (1992). Pituitary adenylate cyclase activating polypeptide (PACAP) with 27 residues. Conformation determined by 1H NMR and CD spectroscopies and distance geometry in 25% methanol solution. Int. J. Pept. Protein Res. 40: 456—464. PMID 1483839

Примітки

  1. ↑ Захворювання, генетично пов'язані з ADCYAP1 переглянути/редагувати посилання на ВікіДаних.
  2. ↑ Human PubMed Reference:.
  3. ↑ Mouse PubMed Reference:.
  4. ↑ HUGO Gene Nomenclature Commitee, HGNC:241 (англ.) . Процитовано 12 вересня 2017.{{cite web}}: Обслуговування CS1: Сторінки з параметром url-status, але без параметра archive-url (посилання)
  5. ↑ UniProt, P18509 (англ.) . Архів оригіналу за 17 серпня 2017. Процитовано 12 вересня 2017.

Див. також

  • Хромосома 18
Молекула міоглобіну Це незавершена стаття про білки.
Ви можете допомогти проєкту, виправивши або дописавши її.

П:  Портал «Біологія» П:  Портал «Хімія»